| Successful modification | The parasite was generated by the genetic modification |
| The mutant contains the following genetic modification(s) |
Gene mutation
|
| Reference (PubMed-PMID number) |
Reference 1 (PMID number) : 25658939 |
| MR4 number |
|
| top of page |
| Parent parasite used to introduce the genetic modification |
| Rodent Malaria Parasite | P. berghei |
| Parent strain/line | P. berghei ANKA |
| Name parent line/clone |
Not applicable
|
| Other information parent line | |
| top of page |
| The mutant parasite was generated by |
| Name PI/Researcher | A.J. Radtke; I.A. Cockburn; F. Zavala |
| Name Group/Department | Johns Hopkins Malaria Research Institute and Department of Molecular Microbiology and Immunology |
| Name Institute | Johns Hopkins Bloomberg School of Public Health, Johns Hopkins University |
| City | Baltimore |
| Country | USA |
| top of page |
| Name of the mutant parasite |
| RMgm number | RMgm-1171 |
| Principal name | CS5MΔN |
| Alternative name | |
| Standardized name | |
| Is the mutant parasite cloned after genetic modification | Yes |
| top of page |
| Phenotype |
| Asexual blood stage | Not different from wild type |
| Gametocyte/Gamete | Not different from wild type |
| Fertilization and ookinete | Not different from wild type |
| Oocyst | Not different from wild type |
| Sporozoite | See RMgm-609 for analyses of mutant sporozoites that lack the entire N terminus excluding the signal sequence (including region I). Salivary gland sporozoites are produced but after intradermal inoculation into mice, most sporozoites did not reach the liver but were trapped in the skin. After intravenous infection they show a normal/higher infectivity. |
| Liver stage | See RMgm-609 for analyses of mutant sporozoites that lack the entire N terminus excluding the signal sequence (including region I). Salivary gland sporozoites are produced but after intradermal inoculation into mice, most sporozoites did not reach the liver but were trapped in the skin. After intravenous infection they show a normal/higher infectivity. |
| Additional remarks phenotype | Mutant/mutation
In the mutant (CS5MΔN) the wild type cs gene is replaced with a mutated cs gene carrying 5 mutations that changed the natural H-2Kd restricted epitope SYIPSAEKI to SIINFEKL, an H-2Kb restricted epitope and the mutated cs gene lacks the entire N terminus excluding the signal sequence (including region I).
Protein (function)
The CS protein is the major protein on the surface of sporozoites and is critical for development of sporozoites within the oocysts and is involved in motility and invasion of both the salivary gland of the mosquito and the liver cells. The protein is also found on the oocyst plasma membrane and on the inner surface of the oocyst capsule. Specific motifs in CS are involved in sporozoite binding to mosquito salivary glands and in sporozoite attachment to heparan sulfate proteoglycans in the liver of the mammalian host. During substrate-dependent locomotion of sporozoites, CS is secreted at the sporozoite anterior pole, translocated along the sporozoite axis and released on the substrate at the sporozoite posterior pole. Following sporozoite invasion of hepatocytes, the CS is released in the host cell cytoplasm.
Phenotype
See additional information below
Additional information
From the paper:
'As a second approach, we generated mutant parasites that expressed the SIINFEKL epitope in a CS-restricted manner and were unable to migrate out of the skin due to a deletion in the N-terminal third of the CS protein (RMgm-609], P. berghei CS5MΔN. In further agreement with the hypothesis that sporozoite motility is required for parasite entry into the lymphatics, P. berghei CS5MΔN sporozoites exhibited a severe impairment in their migration to the DLN. To evaluate the effect of these changes in DLN access on the development of cell-mediated immunity, mice were given CFSE-labeled OT-1 cells, injected ID with P. berghei CS5M (RMgm-609] or P. berghei CS5MΔN sporozoites, and OT-1 proliferation was examined 3 days later in the DLN. OT-1 proliferation was significantly reduced in mice injected with P. berghei CS5MΔN sporozoites. To determine whether the diminished CD8+ T cell response observed at day 3 was due to a delay in sporozoite migration to the DLN, rather than an absolute reduction, we measured the expansion of OT-1 cells in the DLN, spleen, and liver 10 days after ID inoculation of P. berghei CS5M or P. berghei CS5MΔN sporozoites. In line with our previous findings, we found that ID immunization with P. berghei CS5MΔN sporozoites led to drastically reduced OT-1 responses 10 days after immunization as compared to P. berghei CS5M sporozoites. Importantly, when injected IV, P. berghei CS5MΔN sporozoites were fully infectious and induced similar OT-1 responses in the spleen and liver as compared to control parasites (P. berghei CS5M). These findings demonstrate that the SIINFEKL epitope is expressed by the mutant parasite and is efficiently presented by APCs upon sporozoite access to lymphoid organs. Together, our studies with Fab-treated and transgenic parasites establish a critical role for sporozoite migration to the DLN in CD8+ T cell priming after ID inoculation.
Other mutants
RMgm-613: A mutant with the wild type cs gene replaced with a mutated cs gene carrying 5 mutations that changed the natural H-2Kd restricted epitope SYIPSAEKI to SIINFEKL, an H-2Kb restricted epitope
RMgm-609: A mutant with the wild type csp replaced with a mutated csp containing a specific deletion of entire N terminus, (including region I) and excluding the signal sequence (amino acids NKSIQAQRNLNELCYNEGNDNKLYHVLNSKNGKIYNRNTVNRLLADAPEGKKNEKKNEKIERNNKLKQP) |